PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G110700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 563aa    MW: 60743.1 Da    PI: 5.5511
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G110700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS342.29.1e-1051935623374
                GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                         + Ll+c +  +  d +la   L +++  as dgdp +R+a+yf+ ALa+rla    +  ++ ++ ++++  s+e +  +k++++++P+ kf
  Sevir.9G110700.1.p 193 QSLLACSRTAA-ADPALAAVELVKVRAAASDDGDPAERVAFYFADALARRLAC---GGGAQPSTAPDTRFASDELTLCYKTLNDACPYSKF 279
                         67999999655.588999999999****************************8...22233333444444599999*************** PP

                GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         +hlta qaIlea+  ++++Hi+Df+i qG+QW+aLlqaLa+Rpeg+p ++Ri gv sp  g   + +l +t  rL++fA+ lgv+fef + 
  Sevir.9G110700.1.p 280 AHLTASQAILEATGAATKIHIVDFGIVQGIQWAALLQALATRPEGKPsRVRISGVPSPYLGpkPAASLAATSARLRDFAKLLGVDFEFVP- 369
                         *******************************************887769********998888999************************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
                         + + +++l+ +++ v+++Ea+aVn++lql++ll   ++++++ ++vL+l kslsP vv++ e e+++n++ F++rf++al yy  +f+sl+
  Sevir.9G110700.1.p 370 LLRPVHELDRSDFLVESDEAVAVNFMLQLYHLL---GDSDEPVRRVLRLAKSLSPSVVTLGEYEVSLNRAGFVDRFANALCYYKPVFESLD 457
                         599******************************...66666777*********************************************** PP

                GRAS 273 aklpreseerikvErellgreivnvva.cegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslv.l 360
                         + ++r+s er+ vEr ++g++i+ +v   egaer+ r+   ++W+  +e +GF+pv+ls++a++qa+ ll +++ +  y++ e   +++ l
  Sevir.9G110700.1.p 458 VAMARDSPERVRVERCMFGERIRRAVGpEEGAERTDRMAASREWQTLMECCGFEPVKLSNYAMSQADFLLWNYDaKYKYSLVELPPAFLsL 548
                         **************************8356899*****************************************88889999*9999988* PP

                GRAS 361 gWkdrpLvsvSaWr 374
                          W++rpL++vSaWr
  Sevir.9G110700.1.p 549 AWEKRPLLTVSAWR 562
                         *************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.636165540IPR005202Transcription factor GRAS
PfamPF035143.1E-102193562IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 563 aa     Download sequence    Send to blast
MAYMCADSGN LMAIAQQVIQ QQQQQQQQHH QRHHHHHHLP PPPMQLPPRQ APPMPPAPAP  60
PHGQIPGASL PYGGAAWPHH SEHFFSDAFV GASAADAVFS DLAAAADFDS DVWMDSLIGD  120
PPFADSDLER LIFTTPPPPV PVPAPAAAAH VDAAAQPEAA APASLPQPAA VAAPAACSSP  180
SFMDASCSEP VLQSLLACSR TAAADPALAA VELVKVRAAA SDDGDPAERV AFYFADALAR  240
RLACGGGAQP STAPDTRFAS DELTLCYKTL NDACPYSKFA HLTASQAILE ATGAATKIHI  300
VDFGIVQGIQ WAALLQALAT RPEGKPSRVR ISGVPSPYLG PKPAASLAAT SARLRDFAKL  360
LGVDFEFVPL LRPVHELDRS DFLVESDEAV AVNFMLQLYH LLGDSDEPVR RVLRLAKSLS  420
PSVVTLGEYE VSLNRAGFVD RFANALCYYK PVFESLDVAM ARDSPERVRV ERCMFGERIR  480
RAVGPEEGAE RTDRMAASRE WQTLMECCGF EPVKLSNYAM SQADFLLWNY DAKYKYSLVE  540
LPPAFLSLAW EKRPLLTVSA WR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A0.01885621375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7270180.0KJ727018.1 Zea mays clone pUT3999 GRAS transcription factor (GRAS55) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981941.10.0PREDICTED: scarecrow-like protein 4
TrEMBLK4A7U80.0K4A7U8_SETIT; Uncharacterized protein
STRINGSi034954m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP85693748
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66770.11e-132GRAS family protein